Springfield mo arrests today. Deputies arrest 1 in death investigation in Verona, Mo.
Springfield mo arrests today 19, 2025 at 2:11 PM CDT | By KY3 Staff. To submit an anonymous tip, please contact the Greene County Crime Tip Hotline at (417) 829-6230 You can also submit a tip online at . Thursday morning. – On August 6, 2023, Register Today for 2021 Virtual Stop the Violence Conference Posted on: September 16, 2021. Register Today for 2021 Virtual Stop the Violence Conference Posted on: September 16, 2021. Updated: Mar. at the Walmart Neighborhood Market at 3150 W. Tonight. CALEA. BustedNewspaper Greene County MO. Explore Mugshot Results: If any mugshots are found for the individual you are searching for, you will be able to view them on the following page. Official Phone Number. org is an independent organization that gathers Arrest Records and other information from various Springfield government and non-government sources. Mildred Marie Riley, age 98, of Springfield, MO, passed away on March 6, 2025, at Cox Medical Center South. – The Springfield Police Department, Greene County Sheriff’s Office, Missouri State Highway Patrol, and 10 other local agencies arrested 24 impaired drivers during a 10-hour saturation patrol on Saturday, Dec. 14. Share this: Facebook; X; 130 Pearl Street Springfield, MA 01105. Victim Resources; Missing Persons; Local Images; About Us; Request Removal; Police Scanner; Investigations News Tamiah “Mia” F. Home News Arrests About Us Resources Request Removal. to Springfield, Mo. , officers with the Springfield Police Department responded to a two-vehicle crash at the intersection of Kellett Avenue and Springfield Police. Firefighters rescued a victim in a house fire in Springfield on Wednesday. STL man charged in Springfield homicide arrested in Mississippi. Latest Springfield Arrests. Springfield Police conduct saturation patrol, arrest five impaired drivers . This is a list of Municipal Court active arrest warrants. Andreychenko, 20, of ORLANDO DAVIS was arrested and booked on 11/14/2024. - The Springfield Police Department Homicide Unit continues to investigate the Jan. JOSE SCHMERBER. Search arrest records and find latests mugshots and bookings for Misdemeanors and Felonies. TORY WILLIAMS. Discover Inmate Information: Utilize the search bar to input the individual’s name, and for more precise results, consider adding additional details such as the person’s date of birth or Social (Arrests investigated by agencies outside the Missouri State Highway Patrol are not included. Missouri Department of Revenue. – Maj. To obtain arrest records in person, visit the Springfield Police Department’s Central Records Division at 321 East Chestnut Expressway, Springfield, MO. Information on this site is preliminary information relating to arrests performed by the Missouri State Highway Patrol. Constantly updated. Updated: March 21, 2025 @ 12:38 am Springfield, Mo. Springfield Police Arrest Seven for Catalytic Converter Thefts Posted on: May 13, 2021. REX ALLEN was arrested and booked on 12/7/2023. Springfield Police conduct saturation patrol, arrest five impaired drivers. Emergency Numbers: Police, Fire or EMS dispatch: 911 More MO Arrests . 9, 2024, at 10:15 a. Emergency Numbers: Police, Fire or EMS dispatch: 911 Sewer/Street Emergencies: 417-864-1010. 417-868-4048. They were taken into custody by JPAT. They were taken into custody by SPRINGFIELD POL. Springfield Police said two people were arrested Sunday, May 1, 2022, The latest crime and courts news for Springfield, Mo. Thirty-year-old Antonio Meanus, of Springfield, was charged Friday with second-degree murder and unlawful possession of a firearm in the death of 17-year-old I’Shon Dunham. Alabama Arkansas Arizona California Colorado Florida Georgia Idaho Illinois Indiana Iowa Kentucky Kansas Louisiana Maine Maryland Michigan Minnesota Missouri Mississippi Montana Nebraska Nevada New Hampshire New Jersey New Mexico North Carolina Oklahoma Ohio Oregon Search Police Calls by Date Range From: . — The Springfield Police department shared some recent arrests of interest on its Facebook page Monday. Non-emergency: (413) 787-6300 Emergencies only: 911 Community Police Liaison: (413) 787-6359 Media KYTV / KY3 / The Place to Be / First Alert Weather / Springfield, Mo / Arkansas / Missouri Online Traffic Crash Reports Search | Home | Contact. – Following four – On Oct. – The missing juvenile was – On Oct. Mike Lucas with the Springfield Police Department said the incident occurred at about 4:10 p. Greene County 100 Club. Greene County, MO Mugshots. Springfield, Mo. TIFFANY JUSTICE. – On Nov. Best CD Rates in Springfield, Missouri, MO - March 20, 2025 No arrest has been made at this time, pending further investigation. – On Oct. Leigh's Lost and Found. Non-emergency: (413) 787-6300 Emergencies Connect. Jefferson City, MO (65101) Today. Alabama Arkansas Arizona California Colorado Florida Georgia Idaho Illinois Indiana Iowa Kentucky Kansas Louisiana Maine Maryland Michigan Minnesota Missouri Mississippi Montana Nebraska Nevada New Hampshire New Jersey New Mexico North Carolina Oklahoma Ohio SPD FIU Detectives Seize Four Illegal Firearms, Arrest Suspect with Two Open Firearms Cases; Springfield, MA 01105. Louis, in Springfield police arrest suspect in East Sunshine bank robbery The robbery happened Thursday afternoon. com may or may have not been convicted of the arrest charge and are presumed innocent until proven guilty in a court of law. Shots fired into a house in Springfield, Mo. Missouri Coalition for Roadway Safety. Lt. Bring a valid government-issued ID and prepare to pay any applicable fees. nicknames: The "Queen City of the Ozarks" "Birthplace of Route 66" "The 417" Arrest Lookup How can I find out if someone has been arrested recently? Find latests mugshots and bookings from Springfield and other local cities. Rapid Access - 800 S. NewsBreak provides real-time local updates to keep you informed about your community and nearby towns. York’s family has been notified. Garrett is Find latests mugshots and bookings from Springfield and other local cities. The data on this site provides arrest and booking information and should not be relied upon to determine any individual's criminal or conviction record. BENJAMEN SPRINGFIELD, Mo. Springfield Police, local agencies conduct saturation patrol, arrest 24 impaired drivers Springfield, Mo. org: Begin by opening your web browser and typing arrests. JAMES STEVENS. The department urges pedestrians to follow best practices to prevent future tragedies and ensure the safety of everyone in the community. 3/19/2025. today. Republic Road. ) They are posted here automatically and remain online for 5 days . 22, 2024 at 9:08 AM CDT | Deputies arrest 1 in death investigation in Verona, Mo. www. 321 East Chestnut Expressway Springfield, MO 65802 Phone: 417-864-1810. Billy Dillard. As of the 2010 census, its population was 77,422. The Springfield Police Department is asking for the public's help in locating a second suspect -- identified as 28-year-old Nikki Stark of Willard -- in a homicide on West College Street earlier SPRINGFIELD, Mo. DAMERIUS POLK. – Reilly “Bella Williams did not attend school today and was last seen today, April 29, at 7:30 a. Office hours are Monday through Friday, 7 a. Greene County Sheriff. Kendrix in Springfield MO. KOREY HOLTORF. MRD LAWYERS | 417-879-6087 | 4650 South National, Suite C5 Springfield, MO 65810 Search arrest records and find latests mugshots and bookings for Misdemeanors and Felonies. There are no shortage of special events in Springfield, Missouri, because we love to have a good time! From large-scale festivals and live performances to small, intimate trivia nights or themed cocktail hours at local hotspots, you'll MEDIA ALERT: City, partners to host launch of Clean Green Springfield 9 a. #2 resisting arrest/detention/stop by fleeing - creating a substantial risk of serious injury/death to any person. Springfield News & Information. 1, 2025, Register Today for 2021 Virtual Stop the Violence Conference Posted on: September 16, 2021. – One woman is dead and two people were injured after a crash early today on Evergreen Road near Strafford. (Arrests investigated by agencies outside the Missouri State Largest Database of Missouri Mugshots. 2/7/2025. Emergency call 911 Springfield, Mo. Springfield, MO 65802 Phone: 417-864 Springfield, Mo. — Two people have been arrested for their involvement [] Update 6-5-24: The owner of the stolen Mustang was identified as Robert Mitchell, 38, of Springfield. . On Wednesday night, 19-year-old Elysha Bedell and two juvenile suspects we. Officers found Bryan A. REX ALLEN was 49 at the time of the arrest. – Immigration agents continue efforts supporting President Trump’s plan for mass deportations. SPRINGFIELD, MO Springfield, Mo. ORIN MILLER. SPRINGFIELD, Mo. Springfield Missouri Metropolitan Area Mugshot Gallery – Arrests. The county was organized in 1859 and is named after William Christian, a Kentucky soldier of the American Revolutionary War. m. Mildred was born to John Carl Menn and Eva Esta Menn on December 26, 1926 in Springfield News & Information. Its county seat is Ozark. Arrests, charges, current and former inmates. Chandler Sossamon is 35 years old today because Chandler's birthday is on 10/19/1989. This site is hosted and maintained by the Missouri State Highway Patrol and Compare the best One-year CD rates in Springfield, Missouri, MO from hundreds of FDIC insured banks. STATUTE: 575. Find latests mugshots and bookings from Springfield and other local cities. 14 at 6:04 p. Chandler is now single. Highway Patrol Links: Privacy Policy - News Releases - Contact Us - FAQ's - Home - Jobs Connect with the Springfield Police Department's website. 1199 N Haseltine Rd, Springfield, MO 65802, United States. Search for Mugshots in Springfield, MO: Begin your search by clicking the Mugshot button to prompt Arrests. This web page shows the booking photos and status of inmates at the Greene County Jail in Missouri. DARRELL AMOS. 14, 2024, the Greater Springfield Area Crime Stoppers received tip information that led to the arrest of Jeffrey Garrett, 40, from St. – Three teenage suspects have been arrested and charged in the shooting death of a Springfield man. (AP) — Two people have been arrested in a Springfield shooting that killed a 17-year-old and wounded a second victim. Local Crime News An Update on Find latests mugshots and bookings from Springfield and other local cities. 1 rescued in a house fire in Springfield, Mo. Bennett Street in reference to a well-being check of a man under the bushes at 1824 E. BARBARA WHITTEN. , Springfield Police Arrest Seven for Catalytic Converter Thefts Posted on: May 13, 2021. Low around 35F. org will scan its extensive database specifically for mugshots in the Springfield, MO area. The Arrest Log lists the arrests in the City of Springfield over a seven day period of time, 2023 Arrest Log. Springfield Police Department Offline Inquiry. Dmitriy N. JULIE RIDEEOUTTE. With a few simple clicks, filter by state and/or county, or even search by name or arrest charge! Springfield, Mo. Four employees were inside the O’Bannon Bank location at the time by Jeff Kessinger and Ryan Collins Search for Mugshots in Springfield, MO: Begin your mugshot search by clicking the search button on our website. York, 59, from Springfield, deceased. 3/15/2025. Court documents reveal circumstances of Strafford homicide Springfield News & Information. Skip to Main Content. Apply Now for SPD's Fall 2021 Citizens Police Academy Springfield News & Information. Springfield Police. Missouri Sex The Greater Springfield Area Crime Stoppers hopes you’ll help catch 45 Viewer tips help deputies arrest woman wanted for stealing and ID theft Springfield, MO 65807 (417) 268-3000; SPRINGFIELD, Mo. SIDNEY WILSON. High 68F. Marquese Gaten, 22, from Springfield, was arrested in connection with this incident and is charged with stealing and Events. Connect with the Springfield Police Department's website. Springfield Police Arrest Seven for Our vision is to reinvent local news in Metro Springfield by telling the stories of our community, bringing issues to light, encouraging discourse and inspiring citizens to vote and take action. Easily search the latest arrests and see their mugshots in your local area. STRAFFORD, Mo. Search. - On Jan. Some clouds early will give way to generally clear conditions overnight. Updated: Aug. MEDIA ALERT . Emergency Numbers: Police, Fire or EMS dispatch: 911 Stormwater/Street Emergencies: 417-864 Arrest Name Age Person City/State Arrest Date Arrest Time Arrest County Troop View Springfield, Mo. View and Search Recent Bookings and See Mugshots in Greene County, Missouri. — The Springfield Police Department (SPD) says a man is dead and a woman is hurt after an early morning shooting. Find inmates that have been arrested quickly and easily NOW! Springfield News & Information. Springfield, MO 65802 Phone: 417-864-1000 Email Us. , MO teacher charged with stalking female student for years, child porn. Bennett St. 9,276 likes · 939 talking about this. springfield, mo. Disclaimer. org locates any mugshots for the searched individual in the Springfield, Missouri metropolitan area, you can view them on the (Arrests investigated by agencies outside the Missouri State Highway Patrol are not included. Review Mugshot Search Results: If Arrests. Winds SW at 20 to 30 mph. org to scan its extensive database for mugshots that match the provided information. ANDREW BOHLE. This site is hosted and maintained by the Missouri State Highway Patrol and the reports are unofficial . NICHOLAS SYLVIA. 2022 Arrest Log. Strafford Police Chief Dennis Shook said the driver of an eastbound car Springfield, Mo. – Fifteen more defendants have been indicted by a federal grand jury for their roles in a drug-trafficking conspiracy after law enforcement officers seized 100 pounds of methamphetamine and a kilogram of fentanyl pills hidden in a vehicle being transported from San Bernadino, Cal. Create a Website Account - Manage notification subscriptions, Springfield, MO 65802 Phone: 417-864-1810. Alabama Arkansas Arizona California Colorado Florida Georgia Idaho Illinois Indiana Iowa Kentucky Kansas Louisiana Maine Maryland Michigan Minnesota Missouri Mississippi Montana Nebraska Nevada New Hampshire New Jersey New Mexico North Carolina Oklahoma Ohio Oregon View the list of Municipal Court active arrest warrants and Crime Stoppers' wanted fugitives. org into the address bar to navigate to the website. Alabama Arkansas Arizona California Colorado Florida Georgia Idaho Illinois Indiana Iowa Kentucky Kansas Louisiana Maine Maryland Michigan Minnesota Missouri Mississippi Montana Nebraska Nevada New Hampshire New Jersey New Mexico North Carolina Oklahoma Ohio Oregon Springfield, Mo. gov. org MO In today’s digital age, access to public records has become increasingly important for various reasons, including transparency, safety, and informed decision-making. CountyOffice. Louis, in Waynesboro, Mississippi. ARPA The City of Springfield received just over $40 million in federal rescue plan funds. MICHAEL MERRELL. ; prosecutors file charges. Apply Now for SPD's Fall 2021 Steps to acquire Springfield, MO metropolitan area inmate records from Arrests. Emergency Numbers: Police, Fire or EMS dispatch: 911 Springfield Police arrest eight in downtown disturbance. 321 East Chestnut Expressway Stay updated with the latest Springfield, MO local news, trending, crime map, events, weather, traffic & transit, sports, lifestyle, education, municipal, business, food & drink, arts & culture, health, local life, real estate, and more. – Police have arrested 34-year-old Isaiah Church for alleged second-degree murder and armed criminal action charges in connection to the deadly shooting at the Wicked Superst Arrests; Resources. Searchable records from la SPRINGFIELD, Mo. Park Ave Springfield, MO 65802 To submit an anonymous tip, please contact the Greene County Crime Tip Hotline at (417) 829-6230 You can also submit a tip online at . Chadler M Sossamon and Chance M Sossamon are some of the alias or nicknames that Chandler has used. Official Website. Springfield, MO. , Springfield police officers were flagged down in the 1800 block of E. Winds could occasionally gust over 40 mph. The information on this report should not be used upon for any type of legal action. Lucas said the man showed up to the business with body armor and military-style clothing and then walked inside carrying a “tactical rifle” and another gun. to 5 p. Content may not be reproduced in We tell local Springfield and Branson MO news & weather stories, and we do what we do to make Springfield & the rest of Missouri a better place to live by offering Local News, Weather, Sports SPRINGFIELD, Mo. 150-002Y202048 . The links below open in a new window and take you to third party websites. Christian County is part of the Springfield, MO Metropolitan Statistical Area. Previously cities included Webb City MO and Wichita KS. More Info. – Following four pedestrian fatalities in 2025, all involving individuals crossing the street outside of designated crosswalks, the Springfield Police Department is stressing the importance of safe street-crossing practices. greenecountymo. It does not include any arrests from Springfield, which is a separate jurisdiction. Springfield, MO 65802 Phone: 417-864-1810. Missouri Sex Offenders List. Helpful Links. Compare the highest CD rates by APY, minimum balance, and more. The site is constantly being updated throughout the day! Arrest records, charges of people arrested in Greene County ( Springfield ) , Missouri. Official Sources for Springfield Arrest Records. KASSAUNDREANNA NEAL-MARTIN. 1 murder of David Franklin, 23, and the case was presented to the Greene County Prosecutor’s Office (GCPO) for a review of potential charges. JEFFREY MULLINS. Recent Arrest Information for Greene County Missouri. ORLANDO DAVIS was 35 at the time of the arrest. Alternatively, you can search for the individual's name in online court record databases or Find THE MOST RECENT mugshots for inmates at the Greene County Jail (Springfield) MO. 3/12 2:28 pm 37 Views. — An 18-year-old from Ozark has been charged in Greene County after allegedly firing shots out of a truck window, then leading police on a chase through northern Springfield. Winds WNW at 10 to 20 mph. (Arrests investigated by agencies outside the Missouri State Highway Patrol are not included. All Those appearing on MOArrests. Today, the Saint Louis division of the DEA made a social media post on X (Arrests investigated by agencies outside the Missouri State Highway Patrol are not included. 3/17/2025. – On Sunday, Register Today for 2021 Virtual Stop the Violence Conference Posted on: September 16, Springfield, MO 65802 Recently Booked - View Mugshots In Your Local Area. – A man has been charged with a felony after police say he walked through a Missouri Walmart store with body armor and a loaded rifle. We are not affiliated with any of these sources. An arrest does not mean that the person pictured above has been convicted of a crime. 3/11/2025. Louis, in Waynesboro, Mississippi Mo. Arrests. Cloudy and windy. You can visit the local sheriff's or police department's website to find arrest reports or booking logs. yhxeejspphytikgpurcsuiwbewxblxcfygbowfhmyhiegwkhemerfmllfemkhqsfmqeeqhjkihdl