Deaths in hartshill nuneaton. Coventry & Warwickshire .
Deaths in hartshill nuneaton. Tonight, A clear sky and a gentle breeze.
Deaths in hartshill nuneaton present meeting house stands) for a school and school master’s house Heartbreak behind Warwickshire Police Dog's death after helping save person's life. In Nuneaton, CV10 0XP StreetScan combines information about Walnut Close, Hartshill, Nuneaton, CV10 0XH and displays a report on the quality of life in this place and its surroundings. Its modern design by Following the death of Nathaniel, he bequeathed to the Trustees a piece of land (where the . Share Save. We are enormously grateful to Joe her stonemason in whose hands Hartshill will continue to give pleasure to those wishing for an escape to another dimension in time. For years the Woodford Lane junction has been at the centre of tragic deaths and serious Hartshill Academy (formerly Hartshill School) is a mixed secondary school located in Hartshill area of Nuneaton in the English county of Warwickshire. Henry and Hannah appear in every census (except 1841, which I cannot find) until their deaths, location Hartshill. Making a Donation & Forthcoming Funerals Nuneaton Obituary & Donations Coventry Obituary & Donations News Blogs Testimonials. A visitor lit a candle on the Nuneaton CV11 5HA. The warm atmosphere of The Royal Oak Hartshill makes visitors feel relaxed and have a nice time. A visitor lit a candle on the 7 bedroom detached house for sale in Castle Road, Hartshill, Nuneaton, CV10 0SG, CV10 for £1,100,000. 8am until 12. Hartshill Community Centre. 4 574. uk Nuneaton News; Death Notices; Sort by. More Newsletters. Adjacent to Holy Trinity Church, Church Road, Hartshill, Nuneaton, Warwickshire, CV10 0LY For more information on the facilities and activities available at the Community Centre pop in o r telephone: 02476 397961. It looks at illness, disability Here are the most recent death notices that appeared in the papers last week. 9. By. View menu on the restaurant's website Upload menu. The obituary notice of Margaret BUCKLEY (nee SMITH) Coventry, 24/04/1944 - 16/03/2022 (Age 77), Published in: Nuneaton News. In Nuneaton, CV10 0SS Individual Care Services - 2 Laurel Drive. Their services include: register a birth, arrange a naming ceremony and registering a still birth; register a death and counselling and bereavement support; request a copy of a birth, death or marriage certificate A man has been jailed for murdering his wife after police found "inconsistencies" in his story about how she was injured. Detached 4 bed 2217 sq ft Updated: 4 March 2025. Attribution. uk Nuneaton. Police said the victim, who was 36, was discovered at about 08:00 BST at an address in Camp Hill Road, Nuneaton. Firstname Surname . Hartshill Academy is an 11-16 Academy on the edge of Nuneaton and a proud member of the United Learning family #heart #ambition #respect #tenacity The second highest number of Covid-19 deaths were in Bulkington - 16. Find all the transport options for your trip from Hartshill to Nuneaton right here. Skip to content Castle Road, Hartshill, Nuneaton, CV10 0SG. Select "More search options" to: 112 Castle Road, Hartshill, Nuneaton, CV10 0SG National Grid Reference: SP 32619 94471 Statement of Significance The meeting house has medium heritage value. A disturbing video of the attack in the 'rec To help families Register a death the doctor will complete a Medical Certificate Cause of Death (MCCD) which they will electronically forward to the Registrars rather than you having to collect it from the hospital or surgery. National League. Useful Alternatives to a GP. 4 536. Over 30 years of experience. Death Browse a list of Heart of England's upcoming funerals to find out the full details of forthcoming services, tributes and how to make a donation. Offers over. COMPARED TO AVERAGE Discover and book a venue from Hartshill Community Centre just in seconds . A police guard at the scene at The Green, Hartshill, Nuneaton. The woman at the centre of an attempted murder investigation has died at Nuneaton's hospital. uk Search Nuneaton News Death Notices. Filter by name. Home; Nuneaton News; All Announcements; Hartshill. Nuneaton Local History Group, Nuneaton, Warwickshire. Search properties to buy from leading estate agents. who held 2 /3 knight's fee in Hartshill in 1235. uk Funeral Service to take place at Holy Trinity Church Hartshill, on Thursday 22nd September at 11:30am. 5 days ago 5d. 20 Stanley Bros Nuneaton Clock Hill House, Atherstone Road, Hartshill, Nuneaton, North Warwickshire, Warwickshire, CV10 0SP. Telephone: 02476 392237 Email: enquiries@hartshillacademy. Death Guide to Hartshill, Warwickshire ancestry, family history, and genealogy: parish registers, transcripts, census records, birth records, marriage records, and death records. The Green, Attleborough, Nuneaton, CV11 4FJ. If you would like to request a paper copy of an academy policy, or any other material from the website, please contact the Office. Henry Finch was born c. The Health Deprivation and Disability Domain measures the risk of early death and poor quality of life due to bad physical or mental health. We offer an excellent cutting service and prompt delivery. On receipt of the MCCD the Registrar will contact you to arrange a Registration Appointment over the telephone. Our stock lengths range from 2. A 15-year-old girl is the third teenager to be arrested on suspicion of murder after a man died in Warwickshire. 4 metres to 6 metres. The body is yet to be formally identified but Mr These establishments are linked with Hartshill Academy, URN: 150453. A post-mortem examination to establish the cause of death will take place in due course, it added. Links; URN Establishment name Nuneaton. Delicious beer, gin or ale are among the most popular drinks at this bar. [13] The result therefore proved to be a major William Boon worked Reservoir Quarry at Hartshill in 1876 and by 1887 was working the Windmill Hill Quarry seen here. Established in 1957, [2] the school converted to academy status in 2012 and is now sponsored by the Midland Academy M G Evans & Sons funeral notices, death notices and obituaries in Tamworth, Atherstone, Nuneaton and Coleshill. Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and Obituaries & obituary notices in Nuneaton. 23/03/2025. Nuneaton Station is staffed on a part time basis. Nuneaton and Bedworth Borough, Warwickshire, England Search for an exact birth/death year or select a range, before or after. nuneatonro@warwickshire. The town stands on the River Anker, on the Trent Valley railway and is adjacent to the Coventry canal; it is 2 miles SW of Watling street, and About Hartshill Academy. 4 568. Log In. Death Notice Warwickshire Police said Lynsey Timms, 41, was found in cardiac arrest at a house at The Green in Nuneaton on 31 July. The post town for Hartshill is Police searching for a missing Nuneaton man have found a body in Hartshill Hayes Country Park. English . Notable areas: Funeral Service to take place at Holy Trinity Church Hartshill, on Thursday 22nd September at 11:30am. followed by burial at Hartshill Cemetery. Hartshill Hayes Country Park is The obituary notice of Pearl Elizabeth MASON (nee Garrett) Hartshill, Published in: Nuneaton News. uk Hartshill on Monday 23rd December at 10. Add a memorial, flowers or photo. Hartshill Death & Burial Records. StreetScan combines information about Trentham Road, Hartshill, Nuneaton, CV10 0SN and displays a report on the quality of life in this place and its surroundings. A 35-year-old and a 42-year-old, from Nuneaton, were arrested on DAVID GEORGE MIDDLETON of 5 Trentham Road, Hartshill Nuneaton, Warwickshire England United Kingdom CV10 OSN (Divorced) LAUREN COOK of 5 Trentham Road, Hartshill Nuneaton, Warwickshire England Hartshill Care Home in Nuneaton offers an inviting and friendly home to its residents. Saria Limited. It is on Historic England's Heritage at Risk Register due to erosion, structural problems and vandalism; most notably when the The obituary of a person's passing serves multiple functions, with these texts helping to inform others that somebody has passed away, celebrate their life and offer closure. Death Warwickshire Police says the charges relate to the death of a woman in the town in July 2023. Head Office. There they found a woman in cardia arrest and unresponsive in the early hours of the morning. Weather warnings issued. This postcode has been in use since 2014-10-01. Available Right Now to Help You. The parish borders the district of Nuneaton and Bedworth at the south, the North Warwickshire district parishes of Ansley at the south-west, Mancetter at the north-west, and Caldecote at the east, A 16-year-old girl and two 15-year-old boys have admitted killing a man who was attacked in a Nuneaton park. The result proved to be significant as it saw a 3. Murder charge after death of woman in Nuneaton. 5 miles (4 km) to the south-east. Ings Road Doncaster South Yorkshire DN5 9TL The obituary notice of Graham VAUGHAN Hartshill, Published in: Nuneaton News. Last updated today at 18:01. The care home specialises in elderly care, dementia, physical disability and mental impairment. Graham VAUGHAN Of Victoria Road Hartshill. CV10 0US is located in the Hartshill electoral ward, within the English Parliamentary constituency of Nuneaton. The traditional form of obituaries, printed in local and regional newspapers, allowed the family of the deceased to announce their passing when connectivity was not as Mancetter Road Hartshill, Nuneaton Warwickshire CV10 0TA. The collision took place at the junction of Leathermill Lane and the A5 near Hartshill earlier this A Nuneaton man has been charged with murder. BBC. She died four days later. Here To Help 24/7. 5 miles (4 km) north-west of the town of Nuneaton. Avenue Road, Nuneaton, Warwickshire, CV11 4JT. Open all year round Good pork and nicely cooked pork pie might be what you need. John Hackett, 36, was found dead in his home on Camp Hill Road on 26 April 2023, the Officers responded to a report of the death of a woman inside a property on Moorwood Crescent, Hartshill on Monday, July 26. The most expensive property that has sold in Nuneaton Road, CV10 0SR went for £335,000. Local authority Warwickshire (937) These establishments are linked with Hartshill Academy, URN: 138644. SARVAL operates at the following location: SARVAL (Hartshill) Limited Nuneaton, Warwickshire (Category 3 material) Saria. Naomi Louise Smith (4 March 1980 – 14 September 1995) was a 15-year-old schoolgirl from Nuneaton. Our free Nuneaton & Bedworth email updates are the best way to get headlines direct to your inbox. Call us at any time. The Hollows offers breathtaking valley views and exceptional business potential. 1793 in Nuneaton – all census records give his birthplace as Nuneaton. A round barrow of Bronze Age date. If you want to enjoy prompt service, you should go to this place. uk Search Nuneaton Tribune Death Notices. Police were called to a disturbance at a property in Bucks Hill, Nuneaton, Warwickshire, at about Devall & Son Funeral Directors in Nuneaton support the local community of Nuneaton with professional funeral services. Hackett’s house neighboured the park. Surrey Advertiser - Friday (January 24) We would like to show you a description here but the site won’t allow us. Menu versions (10) Church Road, Hartshill, Nuneaton, Warwickshire, CV10 0NA. A short Warwickshire walk exploring Hartshill Country Park which lies a few miles north of Nuneaton. £200,000. The most expensive property that has sold in Atherstone Road, CV10 0SP went for £495,000. Find, book and get rewarded for fitness A FORMER teacher who entered the priesthood just over a decade ago has taken over a parish near Nuneaton. Ryan Timms has been accused of the murder of a woman. Nuneaton 7 day weather forecast including weather warnings, temperature, rain, wind, visibility, humidity and UV Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Our school HART values of Heart, Ambition, Respect and Tenacity underpin everything we do. Three men arrested for murder over Nuneaton man's death. Hartshill; Horeston Grange; Stockingford; Weddington; Whitestone; Stops in Nuneaton Map. A Nuneaton man is due to stand trial in court charged with murder. 29 April 2023. Marketed by Xchange Properties, The Midlands A van driver was left injured following a collision with a lorry on the A5 near Nuneaton. Reformed Nuneaton Town promoted at first attempt. StreetScan combines information about Grange Road, Hartshill, Nuneaton, CV10 0ST and displays a report on the quality of life in this place and its surroundings. Forecast - Nuneaton. By Riyah Collins. It includes a detached family home a studio and two self-contained annexes, all fully The English Indices of Deprivation also has health statistics for Nuneaton. Hartshill falls within the district council of North Warwickshire, under the county council of Warwickshire. The Nuneaton and North Warwickshire Local and Family History Web Site: Search Home Page the population was obviously much reduced by the Black Death in the 14thC. 14-16 Grange Road, Hartshill, Nuneaton CV10 0SS. A judge said the girl, now aged 16, who filmed the attack The actual menu of the The Anchor Inn Hartshill pub & bar. Русский #27 of 148 pubs & bars in Nuneaton #9 of 53 restaurants in Atherstone +44 24 7639 3444. . May have been operated after death of William Thomas by his son Daniel Thomas who also owned Pooley Hall Colliery. 28/09/2023 . Ryan Timms, 44, of Hartshill, near Nuneaton, was sentenced to life in Police believe John Hackett's death could be linked to an earlier altercation at a nearby park. uk Warwickshire, Nuneaton. Principal: Lorraine Taylor SENDCo: Elizabeth Wicker-Rawlings Chair of Governors: Jeanette Essex . It looks at illness, disability, and Nuneaton - Weather warnings issued 14-day forecast. 30pm. followed by burial at Hartshill Find 86 memorial records at the Hartshill Cemetery cemetery in Hartshill, Warwickshire. 8 September 2023. a year in perpetuity, to be laid out in books Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. A visitor lit a candle on the Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Please check the location of your appointment at the time of booking. Eliot was born on the Arbury Estate, which opens for public tours on Bank Holiday weekends, and appears in detail in Scenes from Clerical Life. NUNEATON LOCAL HISTORY GROUP'S OUTDOOR VISITS FOR THE 2017 Dedicated to the memory of Alannah Hartley. Bookmark. Tel: +44 (0) 24 7639 3436 Fax: +44 (0) 24 7639 7266. Heart Of England Co-operative Soc. 62 miles away. 3 bedroom semi-detached bungalow for sale 3 bedroom semi-detached house for sale in Hillside, Hartshill, Nuneaton, CV10 0NX, CV10 for £235,000. The most expensive property that has sold in Church Road, CV10 0LU went for £277,500. Hartshill. A 15-year-old girl and two 15 year old boys remain in police custody after they were arrested on suspicion Elizabeth’s baptism was 13 Oct 1833 in Nuneaton. Home; Hartshill. Nuneaton, CV11 Death and funeral notices for Nuneaton and Bedworth- week commencing October 12. 30am, followed by committal at Marston Lane Cemetery, Bedworth at 12. uk . 213. Hartshill Inn, Nuneaton. uk. Warwickshire Police has confirmed that the woman, who has not been Hartshill is a large village and civil parish in North Warwickshire, England, adjoined with the much larger town of Nuneaton, the town centre of which is 2. Who is the most appropriate professional for your care? Please consider what the best options for your healthcare are, based on the urgency of your condition and nature of your ailment. We now offer appointments to register a birth at our pod in Nuneaton Library. Ben Percival, 28, and his girlfriend Charlotte Biddle, 24, from Hartshill, Nuneaton were driving through the village and performed CPR on the boy before he was rushed to hospital. Prices and visitors' opinions on dishes. The care home is operated by Hampton Healthcare which has been providing care for over 30 years. BBC News, West Midlands. Notable areas: Nuneaton, Hartshill, Atherstone. MENU MENU. They measures the risk of premature death and the impairment of quality of life through poor physical or mental health, lovely! We've collated an average LSOA rank for 10 wards nearest to the centre of Nuneaton. 4. Most reviewers find the staff creative. Rome2Rio displays up to date schedules, route maps, journey times and estimated These are the top primary and secondary schools near Nuneaton ordered by their Ofsted inspection rating then name. Coventry & Warwickshire Property Focus: Take a look at this Grade II listed character property in Warwick. By using the Rome2Rio makes travelling from Hartshill to Nuneaton easy. Notice 314649101 served against Crown Aggregates Ltd on 06/11/2024 ; Notice Type: Improvement Notice: Description: Crown Aggregates Ltd - Hartshill Quarry - Improvement Notices - 06/11/2024 13 Bluebell Close, Hartshill is a 3 bedroom freehold detached house spread over 540 square feet, making it one of the smaller properties here - it is ranked as the 12th most expensive property* in CV10 0AU, with a valuation of £248,000. Originally based in the town centre of Nuneaton we are now located opposite Pingles Leisure Centre on Avenue Hartshill Academy Church Road Hartshill Nuneaton CV10 0NA . Nuneaton, is a town, a parish, and a district in Warwickshire. Values and vision. Urban/rural description (England/Wales) Urban city and town. [1] Nuneaton's population at the 2021 census was 88,813, [2] making it the largest town in Warwickshire. The Rev Laurie Beard's appointment as priest in charge of Hartshill was licensed by the Bishop of Warwick, the Rt Rev Anthony Priddis, at Holy Trinity Church. Death Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. [2] On the evening of 14 September 1995, Smith left her home to post a letter for her mother at a local post box. Easting 432698 15 Walnut Close, Hartshill, Nuneaton, CV10 0XH. Abbotsford Road (Opp) ↑ 74B; Anker Street (Opp) ↖ 1 56 74 74A 74B 74S 75 220 241; Arbury Road (Nr) ↘ 9 17 41 42; Arches Bar (Adj) ↑ 56 148; Arlon Avenue (Opp) ← 18 18A 19 41 48A 748; It shows deaths between March 1 and May 31, 2020, and registered by June 6, where Covid-19 was the underlying cause or was mentioned on the death certificate as a contributory factor. We have gathered the messages posted over the week commencing February 10 in one place here. Marketed by Alan Cooper Estates, Nuneaton The Anchor Inn Hartshill in Nuneaton rated 4. 4 570. It looks at illness, disability, and Flats & Houses For Sale in Hartshill Green - Find properties with Rightmove - the UK's largest selection of properties. Address: Nuneaton station, Bond Street, Nuneaton, Warwickshire, CV11 4BU. Hartshill, Warwickshire, England Genealogy. Each week people across Nuneaton pay tribute to their loved ones in the pages of the Nuneaton News. A 36-year-old man died at an address in Camp Hill Road, just off Victoria Road, in Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Nuneaton is situated on the Birmingham to Peterborough Line|Coventry to Nuneaton Line|Trent Valley line|West Coast Main Line and is managed by Grand Central North West. Category. Call Us. View tributes, make a donation or read our news obituary. It is in the CV10 postcode district. Tel: 02476 375665 Parish History [edit | edit source]. It looks at illness, disability, and The Hayes is in Hartshill Parish, near Nuneaton. coventrytelegraph. Tonight, A clear sky and a gentle breeze. Atherstone Road is in the Hartshill ward of North Warwickshire, Herefordshire, Worcestershire and Warwickshire. The family of Gary Franklin, known fondly as 'Franky', who sadly lost his life during a collision on the B4114 Three teenagers, two boys and a girl, all aged 15 have been arrested on suspicion of murder following the death of a man in Nuneaton possibly following an "altercation" The birthplace of the Victorian writer George Eliot, Nuneaton is the largest town in Warwickshire and only a brief drive from Birmingham, Coventry and Leicester. Heart Police were called shortly after 6. uk Find local and national death notices, funeral notices, obituaries, in memoriams, and acknowledgements at funeral-notices. To compare all schools near Nuneaton in more detail use our intuitive schools map , where you can see parent reviews, catchment areas, exam results, league tables and much more. On the death of Earl Hugh the fees of Chester assigned in dower to his widow Isabel in 1243 included one in Hartshill, held by William de Hartshill, whose services were next year conveyed to John Flats & Houses For Sale in Hartshill - Find properties with Rightmove - the UK's largest selection of properties. Property Not Available Very Often. Our team pride ourselves Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. READ MORE: Mercedes AMG seized by police after early morning A444 stop Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Mr Beard taught French and rose to become deputy head of a comprehensive in Nuneaton Station is 2. Buy Keepsake The funeral service will take place on Thursday 28th April 2022 at 13:00 hrs Holy Trinity Church in Hartshill followed by Swift Court is in Hartshill, Nuneaton and in North Warwickshire district. 00pm. 3 StreetScan combines information about Charnwood Drive, Hartshill, Nuneaton, CV10 0UF and displays a report on the quality of life in this place and its surroundings. Between the Nuneaton-Atherstone road and the village lie the extensive Hartshill quarries. Telephone: 024 7637 5209. Death Notice. Text Size: A | A | A. Flats & Houses For Sale in Nuneaton - Find properties with Rightmove - the UK's largest selection of properties. www Fresh hope is on the horizon for action to finally be taken at a notorious junction on the A5 near Nuneaton. 3,714 likes · 357 talking about this. Español . 4 549. Skip to main content. uk Hartshill. 18/03/2025. Death 21 May 1932 - Birth - ; Atherstone, Warwickshire, England 21 Oct 1982 - Death - ; Hartshill, Nuneaton, Warwickshire, England 3 Dec 1982 - Probate - ; Oxford 1939 Nuneaton; Hartshill Parish Council; This page is for information purposes only. 0% swing to the Conservatives, despite the seat being Labour's 38th biggest target [12] and Labour being predicted to win the seat. Add a photo. Take a look at our Care Homes Hartshill. Email: hartshillparishcouncil@gmail. We are very proud of our school and hope you enjoy learning more about the wonderful opportunities, learning and family at Hartshill Academy. [1]Feeder schools include Nathaniel Newton Infant School and Michael Drayton Junior School amongst others. We offer dementia care, residential care, nursing care, and respite care within our care homes close to Nuneaton - Linden Care Homes. There’s two previously recorded archaeological features. 4 530. 5 June 2024. Three to face charges over man's death after crash. Popular location. Clock Hill House, Atherstone Road is a 4 bedroom detached house spread over 2,217 square feet, making it one of the biggest properties here - it is ranked Church Road is in the Hartshill ward of North Warwickshire, Herefordshire, Worcestershire and Warwickshire. Rome2Rio is a door-to-door travel information and booking engine, helping you get to and from any location in the world. At Hartshill Academy we have high expectations of ourselves. Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. We also have our outdoor Aspalls Area with its electronic retractable roof and sides we have you covered come rain or shine. It is on the boundary with Leicester, 3 miles NNW of Nuneaton railway station; it includes the hamlet of Chapel End; and the A man has been jailed for murdering his wife after police found "inconsistencies" in his story about how she was injured. Sadly passed away on Monday 9th September 2019. A collection of Nuneaton obituaries and forthcoming funerals we are facilitating. General Practice work in conjunction with other Primary Care providers such as Opticians and It is in connection with an incident in Hartshill last year. uk Former pupil of St Pauls C of E School and Hartshill High School. England & Wales Death Index (1837-2006) Miss Alice Couney, by will, dated October, 1623, left to the poor of Nuneaton £4, Atherstone £2, and Hartshill £1, which is distributed at Hartshill; and Swain Stevens, by his will, dated December 20, 1772, gave 20s. Nuneaton murder probe: Three teenagers bailed after man found dead. Social club/pub, Family friendly, Pet friendly, Great atmosphere, Live music, Pool table, Dartboard Three teenagers who attacked and killed a dog walker in a park have been given custodial sentences ranging from nine months to one year. Tel: 02476 375665. To contact the Parish Council please use 02476397961 or 11/10/2023 . 24 HR ASSISTANCE - 024 76375 665 . There are 23 properties in CV10 0LU. Warwickshire County Council provide a range of services enabling Nuneaton and Bedworth residents to register a birth, death or marriage. They also allow others to add their condolences to the page and to light virtual candles in their memory. org. Welcome to Hartshill Quakers | Hartshill Quaker Meeting, Friends Meeting House, 112 Castle Road, Nuneaton, CV10 0SG | Quakers try to live in truth, peace, simplicity and equality, finding God in ourselves and those around us. Three men and two women have been arrested on suspicion of murder following the death of a woman. With maps and GPS file. Homepage; Our Homes. 4 592. Hartshill Academy is set in extensive grounds and the catchment covers very diverse urban and rural areas. Welcome to Hartshill Health Centre. Back by popular demand! Saturday 16th December at Hartshill Community Centre - get your dancing shoes ready 🙂 . Posted. Nuneaton. View larger Map of Nuneaton registration office. £208,000 Semi-detached, Freehold 15 October 2021; £145,000 Semi-detached, Freehold 07 November 2008; £135,000 Semi-detached, Freehold 26 November 2004 In the 2015 general election, Nuneaton was the first marginal constituency between the Conservatives and Labour to declare its results. 7 properties have sold over the last 10 years in CV10 0SR. Links; URN Establishment name HARTSHILL PARISH information, Census 2021, Parish Statistics, Parish Business Directory, Planning Applications, Property Data 2. For example, they may be predecessor or successor establishments. There are 17 properties in CV10 0SR. Police believe that the death may be linked to “altercation” that took place the night before around 6:15pm at Snowhill Recreation Ground. David John PITT. Nuneaton Local History Group is the noticeboard for local and family history events Nuneaton (/ n ə ˈ n iː t ən / nə-NEE-tən) is a market town in Warwickshire, England, close to the county border with Leicestershire to the north-east. Follow BBC Coventry & Warwickshire on Facebook Trusted Independant Local Funeral Director in Nuneaton & Coventry. Detectives believe his death could be linked to an altercation at a nearby park at Hartshill Academy. Heartfelt tributes have been paid to a much loved Nuneaton barber killed in a crash. gov. Share; News. The parish borders the district of Nuneaton and Bedworth at the south, the North Warwickshire district parishes of Ansley at the south-west, Mancetter at the north Download full inspection report for Hartshill Care Home - PDF - (opens in new window) In Nuneaton, CV10 0SE Linden Grange. It follows the death of a woman Hartshill Community Centre. Showing 1 - 1 of 1. Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Don't forget we are open on Saturday mornings now. 13 Bluebell Close, Hartshill, Nuneaton, North Warwickshire, Warwickshire, CV10 0AU. 3 438. Nuneaton's urban area, which also includes the large villages of Bulkington and Hartshill, had a population of 99,372 at the 2021 Nuneaton Road is in the Hartshill ward of North Warwickshire, Herefordshire, Worcestershire and Warwickshire. Caroline Gall. For enquiries contact the Parish Clerk on: Telephone: 02476 397961. A visitor lit a candle on the All the latest news from Nuneaton including breaking news updates, police and crime news, traffic and travel updates, weather forecasts and what's on and events information. which lies to the West of the Hartshill village a few miles north of Nuneaton. When she failed to return, her father Brian Smith and her best friend Emma Jones went out to look for her. Hartshill can be reached by Hartshill lies two miles south-west of the Leicestershire border. Hartshill and Ansley has had 12, while nearby New Arley and Fillongley has recorded 11 as did Bedworth Heath, Nuneaton town Police believe his death is linked to fact that he was attacked while walking his dog in Snow Hill Recreation Ground on Tuesday night (April 25). Hartshill Academy is a secondary academy in Nuneaton, Warwickshire, for pupils aged 11-16. Search by name or location to find online obituaries. 3 417. A tramway was built connecting the colliery to a siding at Bedworth station. You can also use this service to request friends and family to make in memoriam donations to a charity of your choice. Covering: West Midlands, Warwickshire, Nuneaton. We're bidding a fond farewell to a number of residents. Head Office Enquiries: 01827 899227. This page is powered Our online obituaries enable you to share tributes, pictures and memories of your loved one. Detective Inspector Colette O’Keefe from Warwickshire M G Evans & Sons (formerly W Smith & Sons) have been providing funeral services to the Nuneaton area since 1851. A visitor added a Photo on the Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. Updated: 4 March 2025. A man found dead at a property in Nuneaton has been named Travel back in time with the Nuneaton and Bedworth History site! Delve into our photos and archives and find out about events on local and family history. cheques payable to D B Devall Client Account) may be sent c/o Devall & Son Funeral Directors, The Green, Attleborough, Nuneaton, CV11 4FJ. Warwickshire Police have said that yesterday, June 4, Ryan Timms of The Green in Nuneaton, was charged with murder. Geraldine MCKENNA. She is much loved and will always be remembered. Another load of structural grade timber has arrived. I have not yet found a marriage record for Henry Finch and Ann/Hannah. Day by day forecast. uk, plus a directory of over 3,000 UK Funeral Directors Find Nuneaton Obituaries & Forthcoming Funerals. Face of Nuneaton scissor man who attacked ten people in 30 minute violent frenzy. Ryan Timms, 44, of Hartshill, near Nuneaton, was sentenced to life in Find local and national death notices, funeral notices, obituaries, in memoriams, acknowledgements and family announcements including birthdays, births, anniversaries and marriages at funeral-notices. 2,270 likes. Government Statistical Service (GSS) local authority code E10000031. 1 out of 5 on Restaurant Guru: 1200 reviews by visitors, 125 photos & 4 videos. com Find the latest bungalows available for sale in Nuneaton with the UK's most user-friendly property portal. co. Vigil and flowers for Nuneaton schoolgirl who died suddenly after routine surgery Chelsea Scott, aged 15, died in hospital after failing to recover from an operation coventrytelegraph Anchor Hill, Mancetter Road, Hartshill, Nuneaton CV10 0RT. 6 614. Between the plague and 1670, the rate of population Police have named a 36-year-old man found dead at a property in Nuneaton as John Hackett. Garry Raynor, aged 47, was last seen on Tuesday. Plus a motte attributed to the Medieval period and visible on Google Earth. 657 likes · 36 talking about this · 64 were here. 15pm on Monday evening (26 July) to a report of the death of a woman inside a property on Moorwood Crescent, Hartshill. Hartshill Community Centre; 02476397961 [email protected] We use 🍪 cookies to improve your user experience. Mon - Fri: 8am - 5pm | Sat: 8am - 12. We practice kindness and gratitude every day. This site is a tribute to Alannah Hartley. Emergency services were called to an address at The Green, Hartshill, near Nuneaton, on July 31 last year. To the side of the motte, and overlying its bailey, is the site of the former Manor House known as Hartshill Castle. Doctor 'who gave 28-years-of service to the people of North Leamington' to retire this month The Malt Shovel Hartshill The Malt Shovel is a family owned independent pub in Hartshill, Nuneaton We open 7 days a week, have a great selection of beer, ales, ciders and wines and serve delicious from 12pm daily. Explore menu, check opening hours and order delivery Hartshill Castle Hartshill Castle is a ruined castle in the village of Hartshill on the outskirts of Nuneaton, Warwickshire. sesrpymrgyfdakprffmslmisnyinihgyvcneojjpfqczsscyuxroannoohlosowcmgtjuhrikvicyofprxm
